,

IGF-1 LR3 1mg

£0.00

+ Free Shipping

Researched Benefits:

    • Promotes muscle growth and development
    • Enhances fat metabolism and reduces body fat
    • Improves recovery and repair
    • Boosts cognitive function and memory

Out of stock

Email when stock available

IGF-1 LR3 1mg is an enhanced version of insulin-like growth factor-1 (IGF-1), developed to improve stability and activity compared to the naturally occurring form. These properties make it a popular choice for research focused on growth factor signaling and related biological processes. Manufactured using modern peptide synthesis techniques, this product is supplied with a strong emphasis on purity and consistency for laboratory use.

Key Features

  • Modified to provide increased stability and extended activity compared to standard IGF-1
  • Produced under strict quality control standards to ensure batch consistency
  • Supplied in lyophilized (freeze-dried) form for improved shelf life and ease of storage

Research Applications

  • Studying cellular growth, differentiation, and survival pathways
  • Exploring metabolic processes related to muscle development and aging
  • Investigating growth factor activity in advanced laboratory research models

Specifications and Documentation:

Material Safety Data Sheet (MSDS): Coming soon

Handling and Storage Guidelines:

  • Intended for research use only
  • Store the lyophilized product in a cool, dry environment, ideally at -20°C for long-term storage
  • Once reconstituted, store refrigerated at 2–8°C and use within a short time frame according to laboratory protocols
  • Avoid repeated freeze-thaw cycles, as this may affect peptide integrity
  • Handle using appropriate laboratory safety practices, including gloves and protective equipment

IGF-1 LR3 1mg is widely used in research environments studying growth factor biology, offering a reliable tool for exploring cellular mechanisms and signaling pathways.

CAS No.

946870-92-4

Purity

≥99%

Sequence

MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C331H519N109O101

Molecular Weight

9117.60 g/mol

Applications

Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders

Synthesis

Solid-phase synthesis

Format

Lyophilized powder

Solubility

Soluble in water or 1% acetic acid

Stability & Storage

Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.

Appearance

White lyophilized powder

Safety Information

Refer to provided MSDS

Shipping Conditions

Shipped at ambient temperature; once received, store at -20°C

Regulatory / Compliance

Manufactured in a facility that adheres to cGMP guidelines

Reviews

There are no reviews yet.

Be the first to review “IGF-1 LR3 1mg”

Your email address will not be published. Required fields are marked *

Shopping Cart